PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7817_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family HD-ZIP
Protein Properties Length: 349aa    MW: 38011.5 Da    PI: 8.4923
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7817_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-18164218256
                                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                          rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  cra_locus_7817_iso_2_len_1338_ver_3 164 RKKLRLSKEQAAILEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 218
                                          788899***********************************************98 PP

2HD-ZIP_I/II1278.1e-41164253191
                          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalk 74 
                                          +kk+rlskeq+++LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+
  cra_locus_7817_iso_2_len_1338_ver_3 164 RKKLRLSKEQAAILEETFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLT 237
                                          69************************************************************************ PP

                          HD-ZIP_I/II  75 eenerLekeveeLreel 91 
                                          een+rL+kev+eLr +l
  cra_locus_7817_iso_2_len_1338_ver_3 238 EENRRLQKEVNELR-AL 253
                                          *************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.2E-204141IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.5E-18152219IPR009057Homeodomain-like
SuperFamilySSF466891.54E-18157221IPR009057Homeodomain-like
PROSITE profilePS5007117.248160220IPR001356Homeobox domain
SMARTSM003892.7E-15162224IPR001356Homeobox domain
CDDcd000865.91E-15164221No hitNo description
PfamPF000463.6E-16164218IPR001356Homeobox domain
PROSITE patternPS000270195218IPR017970Homeobox, conserved site
PfamPF021835.1E-11220254IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.5E-26220263IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MANEKEDAND LRLSLTLGGF GENRKANTTP LPPPPPPPPP TTATHTPFPF NNLLRSGVGF  60
PFMQPQLLRS SSSSSVFGDV FLHQPNSSTA EKNAAGESTR SFFRGIDVNR PATGTDCDEE  120
AIVSSPNSTV SSISGKRSER EENDGDGERP SSSLEDDGGD AAARKKLRLS KEQAAILEET  180
FKEHNTLNPK QKLALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RCCENLTEEN  240
RRLQKEVNEL RALKLSPQFY MNMSPPTTLT MCPQCERVAV SSSAANASSS AATATATSTA  300
SIAAATTSAG IARQPPAIAS NQQPMTTINP WTAIFSKQAL PPHDSCRPR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212220RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-122PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466027e-88HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP951e-123A0A068UP95_COFCA; Uncharacterized protein
STRINGSolyc01g090460.2.11e-105(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485